Lineage for d1yuxa1 (1yux A:1-166)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.1: Ferritin [47241] (10 proteins) 
Protein Nigerythrin, N-terminal domain [140440] (1 species) Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
Uniprot P30820 1-166
Domain d1yuxa1: 1yux A:1-166 [124073]
Other proteins in same PDB: d1yuxa2, d1yuxb2
complexed with fe, fe2
Details for d1yuxa1
PDB Entry: 1yux (more details), 1.6 Å
PDB Description: Mixed valant state of nigerythrin
PDB Compounds: (A:) NigerythrinSCOPe Domain Sequences for d1yuxa1:
Sequence, based on SEQRES records: (download)
>d1yuxa1 a.25.1.1 (A:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap
Sequence, based on observed residues (ATOM records): (download)
>d1yuxa1 a.25.1.1 (A:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvpsayscdlnlisgangeiyetsdm
ypafirkaqeegnskavhvftraklaesvhaerylaayndidap
SCOPe Domain Coordinates for d1yuxa1:
Click to download the PDB-style file with coordinates for d1yuxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yuxa1:
- d1yuxa1 first appeared in SCOP 1.73
- d1yuxa1 appears in SCOPe 2.07
View in 3D
