Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [254992] (3 PDB entries) |
Domain d1yula_: 1yul A: [241066] automated match to d1k4kd_ complexed with cit |
PDB Entry: 1yul (more details), 2 Å
SCOPe Domain Sequences for d1yula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yula_ c.26.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} gkriglfggtfdpvhighmrsavemaeqfaldelrllpnarpphretpqvsaaqrlamve ravagverltvdprelqrdkpsytidtlesvraelaaddqlfmligwdafcglptwhrwe alldhchivvlqrpdadseppeslrdllaarsvadpqalkgpggqitfvwqtplavsatq irallgagrsvrflvpdavlnyieahhlyr
Timeline for d1yula_: