Class g: Small proteins [56992] (92 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Transforming growth factor alpha [57217] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57218] (7 PDB entries) |
Domain d1yufa_: 1yuf A: [44295] |
PDB Entry: 1yuf (more details)
SCOPe Domain Sequences for d1yufa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yufa_ g.3.11.1 (A:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla
Timeline for d1yufa_: