![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.16: YML079-like [117318] (4 proteins) Pfam PF06172; DUF985 |
![]() | Protein Hypothetical protein SO0799 [141607] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [141608] (1 PDB entry) Uniprot Q8EIN8 1-158 |
![]() | Domain d1yuda1: 1yud A:1-158 [124046] Other proteins in same PDB: d1yudb_, d1yudc_, d1yudd_, d1yude_, d1yudf_, d1yudg_, d1yudh_, d1yudi_, d1yudj_ |
PDB Entry: 1yud (more details), 2.7 Å
SCOPe Domain Sequences for d1yuda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltad emwyfhagqsltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvg cmvspgftfddfelfsqeallamypqhkavvqklsrpe
Timeline for d1yuda1: