Lineage for d1ytda2 (1ytd A:1-119)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) 
Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins) 
Protein Nicotinate phosphoribosyltransferase Ta1145 [143193] (1 species) Species Thermoplasma acidophilum [TaxId:2303] [143194] (4 PDB entries)
Uniprot Q9HJ28 1-119
Domain d1ytda2: 1ytd A:1-119 [124007]
Other proteins in same PDB: d1ytda1
Details for d1ytda2
PDB Entry: 1ytd (more details), 2.8 Å
PDB Description: Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum, Native Structure
PDB Compounds: (A:) nicotinate phosphoribosyltransferase from Thermoplasma acidophilumSCOPe Domain Sequences for d1ytda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytda2 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]}
mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldev
lkllegldvdlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgi
SCOPe Domain Coordinates for d1ytda2:
Click to download the PDB-style file with coordinates for d1ytda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytda2:
- d1ytda2 first appeared in SCOP 1.73
- d1ytda2 appears in SCOPe 2.07
View in 3D
