Lineage for d1ytda1 (1ytd A:120-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839615Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)
  6. 2839616Protein Nicotinate phosphoribosyltransferase Ta1145 [141861] (1 species)
    includes extra C-terminal region that wraps around the N-terminal domain and contains a rubredoxin-like subdomain
  7. 2839617Species Thermoplasma acidophilum [TaxId:2303] [141862] (4 PDB entries)
    Uniprot Q9HJ28 120-389
  8. 2839621Domain d1ytda1: 1ytd A:120-389 [124006]
    Other proteins in same PDB: d1ytda2
    has additional subdomain(s) that are not in the common domain

Details for d1ytda1

PDB Entry: 1ytd (more details), 2.8 Å

PDB Description: Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum, Native Structure
PDB Compounds: (A:) nicotinate phosphoribosyltransferase from Thermoplasma acidophilum

SCOPe Domain Sequences for d1ytda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]}
stkaskvrlaagdspffsfgirrmhpaispmidrsayiggadgvsgilgaklidqdpvgt
mphalsimlgdeeawkltlentkngqksvllidtymdekfaaikiaemfdkvdyirldtp
ssrrgnfealirevrwelalrgrsdikimvsggldentvkklreagaeafgvgtsissak
pfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqektcicggsmqnllv
kylshgkrtseyprpkeirsrsmkeleyfk

SCOPe Domain Coordinates for d1ytda1:

Click to download the PDB-style file with coordinates for d1ytda1.
(The format of our PDB-style files is described here.)

Timeline for d1ytda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytda2