Lineage for d1ytba1 (1ytb A:61-155)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431003Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1431004Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1431005Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1431006Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 1431007Domain d1ytba1: 1ytb A:61-155 [41276]
    complexed with DNA containing TATA-box
    protein/DNA complex

Details for d1ytba1

PDB Entry: 1ytb (more details), 1.8 Å

PDB Description: crystal structure of a yeast tbp/tata-box complex
PDB Compounds: (A:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1ytba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytba1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOPe Domain Coordinates for d1ytba1:

Click to download the PDB-style file with coordinates for d1ytba1.
(The format of our PDB-style files is described here.)

Timeline for d1ytba1:

1431007
d1ytba1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ytba2