Lineage for d1ysya1 (1ysy A:3-85)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) 
Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
automatically mapped to Pfam PF08716Protein Nonstructural protein 7, NSP7 [140369] (1 species) Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
Uniprot P59641 3837-3909! Uniprot P59641 3837-3919
Domain d1ysya1: 1ysy A:3-85 [123986]
Other proteins in same PDB: d1ysya2
Details for d1ysya1
PDB Entry: 1ysy (more details)
PDB Description: nmr structure of the nonstructural protein 7 (nsp7) from the sars coronavirus
PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab) (ORF1AB)SCOPe Domain Sequences for d1ysya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysya1 a.8.9.1 (A:3-85) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlceemldnratlq
SCOPe Domain Coordinates for d1ysya1:
Click to download the PDB-style file with coordinates for d1ysya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ysya1:
- d1ysya1 first appeared in SCOP 1.73
- d1ysya1 appears in SCOPe 2.05
- d1ysya1 appears in SCOPe 2.07
- d1ysya1 appears in the current release, SCOPe 2.08
View in 3D
