![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) ![]() |
![]() | Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
![]() | Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81486] (83 PDB entries) Uniprot P11846 |
![]() | Domain d1ysth2: 1yst H:1-35 [43511] Other proteins in same PDB: d1ysth1, d1ystl_, d1ystm_ complexed with bcl, bph, mn, spo, u10 |
PDB Entry: 1yst (more details), 3 Å
SCOPe Domain Sequences for d1ysth2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysth2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]} mvgvtafgnfdlaslaiysfwiflagliyylqten
Timeline for d1ysth2: