Lineage for d1ysth2 (1yst H:1-35)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
annotated by the SCOP(e) curators as 'not a true fold'
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) 
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [81486] (88 PDB entries)
Uniprot P11846
Domain d1ysth2: 1yst H:1-35 [43511]
Other proteins in same PDB: d1ysth1, d1ystl_, d1ystm_
complexed with bcl, bph, mn, spo, u10
Details for d1ysth2
PDB Entry: 1yst (more details), 3 Å
PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution
PDB Compounds: (H:) photosynthetic reaction center (h subunit)SCOPe Domain Sequences for d1ysth2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysth2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten
SCOPe Domain Coordinates for d1ysth2:
Click to download the PDB-style file with coordinates for d1ysth2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ysth2:
- d1ysth2 first appeared (with stable ids) in SCOP 1.55
- d1ysth2 appears in SCOPe 2.07
View in 3D
