Lineage for d1ysth1 (1yst H:36-260)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790505Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1790506Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1790596Domain d1ysth1: 1yst H:36-260 [25482]
    Other proteins in same PDB: d1ysth2, d1ystl_, d1ystm_
    complexed with bcl, bph, mn, spo, u10

Details for d1ysth1

PDB Entry: 1yst (more details), 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution
PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d1ysth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysth1 b.41.1.1 (H:36-260) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlaeya

SCOPe Domain Coordinates for d1ysth1:

Click to download the PDB-style file with coordinates for d1ysth1.
(The format of our PDB-style files is described here.)

Timeline for d1ysth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysth2