Lineage for d1ysja2 (1ysj A:178-292)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) 
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) 
Protein Protein YxeP [143403] (1 species)
dimeric protein closely related to IAA-amino acid hydrolaseSpecies Bacillus subtilis [TaxId:1423] [143404] (1 PDB entry)
Uniprot P54955 178-292
Domain d1ysja2: 1ysj A:178-292 [123976]
Other proteins in same PDB: d1ysja1, d1ysjb1
complexed with ni
Details for d1ysja2
PDB Entry: 1ysj (more details), 2.4 Å
PDB Description: crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family
PDB Compounds: (A:) protein yxePSCOPe Domain Sequences for d1ysja2:
Sequence, based on SEQRES records: (download)
>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkgghasipnnsidpiaaagqiisglqsvvsrnisslqnavvsitrvqag
tswnvipdqaemegtvrtfqkearqavpehmrrvaegiaagygaqaefkwfpylp
Sequence, based on observed residues (ATOM records): (download)
>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgknsidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtf
qkearqavpehmrrvaegiaagygaqaefkwfpylp
SCOPe Domain Coordinates for d1ysja2:
Click to download the PDB-style file with coordinates for d1ysja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ysja2:
- d1ysja2 first appeared in SCOP 1.73
- d1ysja2 appears in SCOPe 2.06
- d1ysja2 appears in the current release, SCOPe 2.08
View in 3D
