Lineage for d1ys6a2 (1ys6 A:7-127)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries)
Uniprot P0A5Z6 7-127
Domain d1ys6a2: 1ys6 A:7-127 [123958]
Other proteins in same PDB: d1ys6a1, d1ys6b1
complexed with ca, gol
Details for d1ys6a2
PDB Entry: 1ys6 (more details), 1.77 Å
PDB Description: Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
PDB Compounds: (A:) Transcriptional regulatory protein prrASCOPe Domain Sequences for d1ys6a2:
Sequence, based on SEQRES records: (download)
>d1ys6a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
g
Sequence, based on observed residues (ATOM records): (download)
>d1ys6a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarvddrvagleagaddylvkpfvlaelvarvkallrrrg
SCOPe Domain Coordinates for d1ys6a2:
Click to download the PDB-style file with coordinates for d1ys6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ys6a2:
- d1ys6a2 first appeared in SCOP 1.73
- d1ys6a2 appears in SCOPe 2.07
View in 3D
