Lineage for d1ys6a1 (1ys6 A:128-233)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
Family a.4.6.1: PhoB-like [46895] (6 proteins)
contains 4-stranded meander beta-sheet in the N-terminal extension
Protein Transcriptional regulatory protein PrrA [140315] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries)
Uniprot P0A5Z6 128-233
Domain d1ys6a1: 1ys6 A:128-233 [123957]
Other proteins in same PDB: d1ys6a2, d1ys6b2
complexed with ca, gol
Details for d1ys6a1
PDB Entry: 1ys6 (more details), 1.77 Å
PDB Description: Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
PDB Compounds: (A:) Transcriptional regulatory protein prrASCOPe Domain Sequences for d1ys6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys6a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq
SCOPe Domain Coordinates for d1ys6a1:
Click to download the PDB-style file with coordinates for d1ys6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ys6a1:
- d1ys6a1 first appeared in SCOP 1.73
- d1ys6a1 appears in SCOPe 2.06
- d1ys6a1 appears in the current release, SCOPe 2.08
View in 3D
