Lineage for d1yrka_ (1yrk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1775885Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 1776006Protein automated matches [190564] (2 species)
    not a true protein
  7. 1776007Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries)
  8. 1776008Domain d1yrka_: 1yrk A: [162285]
    automated match to d1bdya_
    complexed with acy

Details for d1yrka_

PDB Entry: 1yrk (more details), 1.7 Å

PDB Description: The C2 Domain of PKC is a new Phospho-Tyrosine Binding Domain
PDB Compounds: (A:) Protein kinase C, delta type

SCOPe Domain Sequences for d1yrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrka_ b.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmapflriafnsyelgslqaedeanqpfcavkmkealstergktlvqkkptmypewks
tfdahiyegrviqivlmraaeepvsevtvgvsvlaerckknngkaefwldlqpqakvlms
vqyfle

SCOPe Domain Coordinates for d1yrka_:

Click to download the PDB-style file with coordinates for d1yrka_.
(The format of our PDB-style files is described here.)

Timeline for d1yrka_: