Lineage for d1yqga1 (1yqg A:153-263)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
similar dimer to the class I KARIProtein Pyrroline-5-carboxylate reductase ProC [116985] (2 species) Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (3 PDB entries)
Uniprot Q9K1N1
Domain d1yqga1: 1yqg A:153-263 [145920]
Other proteins in same PDB: d1yqga2
complexed with so4
Details for d1yqga1
PDB Entry: 1yqg (more details), 1.9 Å
PDB Description: Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58
PDB Compounds: (A:) pyrroline-5-carboxylate reductaseSCOPe Domain Sequences for d1yqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge
dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq
SCOPe Domain Coordinates for d1yqga1:
Click to download the PDB-style file with coordinates for d1yqga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yqga1:
- d1yqga1 first appeared in SCOP 1.75
- d1yqga1 appears in SCOPe 2.06
- d1yqga1 appears in the current release, SCOPe 2.08
View in 3D
