Lineage for d1yqga1 (1yqg A:153-263)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498190Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. 1498194Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. 1498195Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (2 PDB entries)
    Uniprot Q9K1N1
  8. 1498196Domain d1yqga1: 1yqg A:153-263 [145920]
    Other proteins in same PDB: d1yqga2
    complexed with so4

Details for d1yqga1

PDB Entry: 1yqg (more details), 1.9 Å

PDB Description: Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58
PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d1yqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge
dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq

SCOPe Domain Coordinates for d1yqga1:

Click to download the PDB-style file with coordinates for d1yqga1.
(The format of our PDB-style files is described here.)

Timeline for d1yqga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yqga2