Lineage for d1yptb_ (1ypt B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topology
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
has an extension to the beta-sheet of 3 antiparallel strands before strand 4Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species) Species Yersinia enterocolitica [TaxId:630] [52812] (20 PDB entries) 
Domain d1yptb_: 1ypt B: [32687]
Details for d1yptb_
PDB Entry: 1ypt (more details), 2.5 Å
PDB Description: crystal structure of yersinia protein tyrosine phosphatase at 2.5 angstroms and the complex with tungstate
PDB Compounds: (B:) protein-tyrosine phosphatase yersinia (catalytic domain)SCOPe Domain Sequences for d1yptb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yptb_ c.45.1.2 (B:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
ygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnany
iqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgty
gsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkal
aslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsqls
vedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
SCOPe Domain Coordinates for d1yptb_:
Click to download the PDB-style file with coordinates for d1yptb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yptb_:
- d1yptb_ first appeared (with stable ids) in SCOP 1.55
- d1yptb_ appears in SCOPe 2.07
View in 3D
