Lineage for d1ypob_ (1ypo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608526Domain d1ypob_: 1ypo B: [123826]
    automated match to d1yxja_

Details for d1ypob_

PDB Entry: 1ypo (more details), 3 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group
PDB Compounds: (B:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypob_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf
pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa
fsicqkkanlra

SCOPe Domain Coordinates for d1ypob_:

Click to download the PDB-style file with coordinates for d1ypob_.
(The format of our PDB-style files is described here.)

Timeline for d1ypob_: