Lineage for d1ylna1 (1yln A:138-248)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801987Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. 801988Family b.45.2.1: PilZ domain [141372] (2 proteins)
    Pfam PF07238
  6. 801992Protein Hypothetical protein VCA0042, C-terminal domain [141373] (2 species)
  7. 801996Species Vibrio cholerae [TaxId:666] [141374] (1 PDB entry)
    Uniprot Q9KNC3 138-248
  8. 801997Domain d1ylna1: 1yln A:138-248 [123657]
    Other proteins in same PDB: d1ylna2
    complexed with ose

Details for d1ylna1

PDB Entry: 1yln (more details), 2.2 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1
PDB Compounds: (A:) hypothetical protein vca0042

SCOP Domain Sequences for d1ylna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylna1 b.45.2.1 (A:138-248) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae [TaxId: 666]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltlna

SCOP Domain Coordinates for d1ylna1:

Click to download the PDB-style file with coordinates for d1ylna1.
(The format of our PDB-style files is described here.)

Timeline for d1ylna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylna2