Lineage for d1ylla1 (1yll A:2-196)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138481Family b.82.1.17: PA5104-like [141609] (2 proteins)
    Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family (101979) except a deletion in the interdomain linker region
  6. 1138482Protein Hypothetical protein PA5104 [141610] (1 species)
  7. 1138483Species Pseudomonas aeruginosa [TaxId:287] [141611] (1 PDB entry)
    Uniprot Q9HU79 2-196
  8. 1138484Domain d1ylla1: 1yll A:2-196 [123653]
    Other proteins in same PDB: d1yllb_, d1yllc_, d1ylld_

Details for d1ylla1

PDB Entry: 1yll (more details), 1.64 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1ylla1:

Sequence, based on SEQRES records: (download)

>d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
selrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqr
iisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrar
lqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlt
ahepawvcaveldsl

Sequence, based on observed residues (ATOM records): (download)

>d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
selrilravdyprmpgsteeiardggdgldgfgwrlsiadvgesggfsgfagyqriisvl
egggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlr
vegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepa
wvcaveldsl

SCOPe Domain Coordinates for d1ylla1:

Click to download the PDB-style file with coordinates for d1ylla1.
(The format of our PDB-style files is described here.)

Timeline for d1ylla1: