Lineage for d1ylia1 (1yli A:11-152)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) 
Family d.38.1.1: 4HBT-like [54638] (18 proteins)
Pfam PF03061
Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species) Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry) 
Domain d1ylia1: 1yli A:11-152 [123651]
automatically matched to d1nngb_
complexed with ca, coa, gol
Details for d1ylia1
PDB Entry: 1yli (more details), 1.95 Å
PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase
PDB Compounds: (A:) Putative acyl-CoA thioester hydrolase HI0827SCOP Domain Sequences for d1ylia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}
rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi
kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr
srtiprennqelekalaliseq
SCOP Domain Coordinates for d1ylia1:
Click to download the PDB-style file with coordinates for d1ylia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ylia1:
- d1ylia1 first appeared in SCOP 1.73
- d1ylia1 is called d1ylia_ in SCOPe 2.01
- d1ylia1 appears in the current release, SCOPe 2.08, called d1ylia_
View in 3D
