Lineage for d1ylaa2 (1yla A:1-156)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) 
Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
ubc1 homologue; also contains the C-terminal UBA domain
Species Human (Homo sapiens) [TaxId:9606] [143064] (6 PDB entries)
Uniprot P61086 1-156
Domain d1ylaa2: 1yla A:1-156 [123642]
Other proteins in same PDB: d1ylaa1, d1ylab1
Details for d1ylaa2
PDB Entry: 1yla (more details), 2.4 Å
PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDaSCOPe Domain Sequences for d1ylaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylaa2 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap
SCOPe Domain Coordinates for d1ylaa2:
Click to download the PDB-style file with coordinates for d1ylaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ylaa2:
- d1ylaa2 first appeared in SCOP 1.73
- d1ylaa2 appears in SCOPe 2.02
- d1ylaa2 appears in SCOPe 2.04
- d1ylaa2 appears in the current release, SCOPe 2.08
View in 3D
