Lineage for d1yksa1 (1yks A:185-324)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.14: RNA helicase [52724] (4 proteins)
duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
Protein YFV helicase domain [142330] (1 species) Species Yellow fever virus [TaxId:11089] [142331] (2 PDB entries)
Uniprot P19901 1669-1842! Uniprot P19901 1843-2107
Domain d1yksa1: 1yks A:185-324 [123561]
Details for d1yksa1
PDB Entry: 1yks (more details), 1.8 Å
PDB Description: Crystal structure of yellow fever virus NS3 helicase
PDB Compounds: (A:) Genome polyprotein [contains: Flavivirin protease NS3 catalytic subunit]SCOPe Domain Sequences for d1yksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}
shmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgld
vkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargw
aahraranesatilmtatpp
SCOPe Domain Coordinates for d1yksa1:
Click to download the PDB-style file with coordinates for d1yksa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yksa1:
- d1yksa1 first appeared in SCOP 1.73
- d1yksa1 appears in SCOPe 2.03
- d1yksa1 appears in SCOPe 2.05
- d1yksa1 appears in the current release, SCOPe 2.08
View in 3D
