Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein YFV helicase domain [142330] (1 species) |
Species Yellow fever virus [TaxId:11089] [142331] (2 PDB entries) Uniprot P19901 1669-1842! Uniprot P19901 1843-2107 |
Domain d1yksa1: 1yks A:185-324 [123561] |
PDB Entry: 1yks (more details), 1.8 Å
SCOPe Domain Sequences for d1yksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} shmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgld vkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargw aahraranesatilmtatpp
Timeline for d1yksa1: