Lineage for d1ykkb1 (1ykk B:301-538)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. Domain d1ykkb1: 1ykk B:301-538 [144654]
    Other proteins in same PDB: d1ykka_, d1ykkc_, d1ykke_, d1ykkg_, d1ykki_, d1ykkk_
    complexed with fe; mutant

Details for d1ykkb1

PDB Entry: 1ykk (more details), 2.06 Å

PDB Description: Protocatechuate 3,4-Dioxygenase Y408C Mutant
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1ykkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykkb1 b.3.6.1 (B:301-538) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggrcrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d1ykkb1 are not available.

Timeline for d1ykkb1:

Domains from other chains:
(mouse over for more information)
d1ykka_, d1ykkc_, d1ykkd_, d1ykke_, d1ykkf_, d1ykkg_, d1ykkh_, d1ykki_, d1ykkj_, d1ykkk_, d1ykkl_