| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins) |
| Protein Sulfite reductase alpha-component CysJ N-terminal domain [142049] (1 species) |
| Species Escherichia coli [TaxId:562] [142050] (1 PDB entry) Uniprot P38038 63-208 |
| Domain d1ykga1: 1ykg A:63-208 [123517] N-domain only; the structures of the other domains are also known ((50442), 52369) complexed with fmn |
PDB Entry: 1ykg (more details)
SCOPe Domain Sequences for d1ykga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]}
itiisasqtgnarrvaealrddllaaklnvklvnagdykfkqiasekllivvtstqgege
ppeeavalhkflfskkapklentafavfslgdtsyeffcqsgkdfdsklaelggerlldr
vdadveyqaaasewrarvvdalksra
Timeline for d1ykga1: