SCOPe 2.06: Domain d1yifa1: 1yif A:325-533

Lineage for d1yifa1 (1yif A:325-533)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topology
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)
Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
Species Bacillus subtilis [TaxId:1423] [141163] (1 PDB entry)
Uniprot P94489 325-533
Domain d1yifa1: 1yif A:325-533 [123283]
Other proteins in same PDB: d1yifa2, d1yifb2, d1yifc2, d1yifd2

Details for d1yifa1

PDB Entry: 1yif (more details), 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium

PDB Compounds: (A:) beta-1,4-xylosidase

SCOPe Domain Sequences for d1yifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yifa1 b.29.1.23 (A:325-533) Beta-D-xylosidase C-terminal domain {Bacillus subtilis [TaxId: 1423]}
atypevdefedstlninfqtlripftnelgsltqapnhlrlfghesltstftqafvarrw
qslhfeaetavefypenfqqaaglvnyyntenwtalqvthdeelgrilelticdnfsfsq
plnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidialeskklsddyirgggff
tgafvgmqcqdtggnhipadfryfrykek

SCOPe Domain Coordinates for d1yifa1:

Click to download the PDB-style file with coordinates for d1yifa1.
(The format of our PDB-style files is described here.)

Timeline for d1yifa1: