Lineage for d1yi9a2 (1yi9 A:199-355)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assembliesSuperfamily b.121.1: PHM/PNGase F [49742] (2 families) 
members of this superfamily bind peptide substrates
duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits
Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (17 PDB entries) 
Domain d1yi9a2: 1yi9 A:199-355 [123277]
automated match to d1yi9a2
complexed with cu, gol; mutant
Details for d1yi9a2
PDB Entry: 1yi9 (more details), 1.7 Å
PDB Description: crystal structure analysis of the oxidized form of the m314i mutant of peptidylglycine alpha-hydroxylating monooxygenase
PDB Compounds: (A:) Peptidyl-glycine alpha-amidating monooxygenaseSCOPe Domain Sequences for d1yi9a2:
Sequence, based on SEQRES records: (download)
>d1yi9a2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdeicnly
imyymeakyalsfmtctknvapdmfrtipaeanipip
Sequence, based on observed residues (ATOM records): (download)
>d1yi9a2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgeeicnlyimyymeakyalsfm
tctknvapdmfrtipaeanipip
SCOPe Domain Coordinates for d1yi9a2:
Click to download the PDB-style file with coordinates for d1yi9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yi9a2:
- d1yi9a2 first appeared in SCOP 1.73
- d1yi9a2 appears in SCOPe 2.05
- d1yi9a2 appears in SCOPe 2.07
- d1yi9a2 appears in the current release, SCOPe 2.08
View in 3D
