Lineage for d1yh6b1 (1yh6 B:25-174)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857033Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 857041Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)
  7. 857075Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry)
    Uniprot P62256 4-155
  8. 857077Domain d1yh6b1: 1yh6 B:25-174 [123161]
    automatically matched to 1YH6 A:23-174

Details for d1yh6b1

PDB Entry: 1yh6 (more details), 2.1 Å

PDB Description: Human ubiquitin-conjugating enzyme E2 H
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 H

SCOP Domain Sequences for d1yh6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yh6b1 d.20.1.1 (B:25-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks
psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd
aaamylhrpeeykqkikeyiqkyateealk

SCOP Domain Coordinates for d1yh6b1:

Click to download the PDB-style file with coordinates for d1yh6b1.
(The format of our PDB-style files is described here.)

Timeline for d1yh6b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yh6a1