Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species) |
Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry) Uniprot P62256 4-155 |
Domain d1yh6b1: 1yh6 B:25-174 [123161] automatically matched to 1YH6 A:23-174 |
PDB Entry: 1yh6 (more details), 2.1 Å
SCOP Domain Sequences for d1yh6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yh6b1 d.20.1.1 (B:25-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]} pgkrrmdtdvvklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypfks psigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidplngd aaamylhrpeeykqkikeyiqkyateealk
Timeline for d1yh6b1: