Class b: All beta proteins [48724] (178 folds) |
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) |
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
Protein Plant lipoxigenase [49725] (2 species) |
Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries) |
Domain d1ygea2: 1yge A:1-149 [23634] Other proteins in same PDB: d1ygea1 complexed with fe |
PDB Entry: 1yge (more details), 1.4 Å
SCOPe Domain Sequences for d1ygea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygea2 b.12.1.1 (A:1-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]} mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq gtirfvcnswvyntklyksvriffanhty
Timeline for d1ygea2: