Lineage for d1ygea2 (1yge A:1-149)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) Protein Plant lipoxigenase [49725] (2 species) Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries) 
Domain d1ygea2: 1yge A:1-149 [23634]
Other proteins in same PDB: d1ygea1
complexed with fe
Details for d1ygea2
PDB Entry: 1yge (more details), 1.4 Å
PDB Description: lipoxygenase-1 (soybean) at 100k
PDB Compounds: (A:) lipoxygenase-1SCOPe Domain Sequences for d1ygea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygea2 b.12.1.1 (A:1-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
gtirfvcnswvyntklyksvriffanhty
SCOPe Domain Coordinates for d1ygea2:
Click to download the PDB-style file with coordinates for d1ygea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ygea2:
- d1ygea2 first appeared (with stable ids) in SCOP 1.55, called d1yge_2
- d1ygea2 appears in SCOPe 2.07
View in 3D
