Lineage for d1yfza1 (1yfz A:3-180)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species) 
Species Thermoanaerobacter tengcongensis [TaxId:119072] [142552] (1 PDB entry)
Uniprot Q8R7L0 3-180
Domain d1yfza1: 1yfz A:3-180 [123098]
complexed with act, imp, mg
Details for d1yfza1
PDB Entry: 1yfz (more details), 2.2 Å
PDB Description: novel imp binding in feedback inhibition of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferaseSCOPe Domain Sequences for d1yfza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
spmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpl
sidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkp
rslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely
SCOPe Domain Coordinates for d1yfza1:
Click to download the PDB-style file with coordinates for d1yfza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yfza1:
- d1yfza1 first appeared in SCOP 1.73
- d1yfza1 appears in SCOPe 2.07
View in 3D
