![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (2 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (1 protein) possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak this is a repeat family; one repeat unit is 1u4c A:12-56 found in domain |
![]() | Protein Cell cycle arrest protein BUB3 [110290] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110291] (4 PDB entries) |
![]() | Domain d1yfqa_: 1yfq A: [116680] complexed with act, ca; mutant |
PDB Entry: 1yfq (more details), 1.1 Å
SCOP Domain Sequences for d1yfqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki acsdnilclatsddtfktnaaidqtielnassiyiifdyenp
Timeline for d1yfqa_: