Lineage for d1yf2a2 (1yf2 A:221-425)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615652Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 2615653Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 2615681Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
    Pfam PF01420
  6. 2615686Protein Bipartite methylase S protein MJ0130 [143982] (1 species)
    duplication: comprises two repeats of this domain, separated by a coiled coil made by additional long helices at the C-end of each repeat
  7. 2615687Species Methanocaldococcus jannaschii [TaxId:2190] [143983] (1 PDB entry)
    Uniprot Q57594 1-220! Uniprot Q57594 221-425
  8. 2615689Domain d1yf2a2: 1yf2 A:221-425 [123043]

Details for d1yf2a2

PDB Entry: 1yf2 (more details), 2.4 Å

PDB Description: Three-dimensional structure of DNA sequence specificity (S) subunit of a type I restriction-modification enzyme and its functional implications
PDB Compounds: (A:) Type I restriction-modification enzyme, S subunit

SCOPe Domain Sequences for d1yf2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf2a2 d.287.1.2 (A:221-425) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]}
igeipedwevfeikdifevktgttpstkkseywengeinwitpldlsrlnekiyigsser
kvtkialekcnlnlipkgsiiistrapvgyvavltvestfnqgckglfqknndsvntefy
ayylkfkknllenlsggstfkelsksmlenfkiplppleeqkqiakilssvdksielkkq
kkeklqrmkkkimellltgkvrvkt

SCOPe Domain Coordinates for d1yf2a2:

Click to download the PDB-style file with coordinates for d1yf2a2.
(The format of our PDB-style files is described here.)

Timeline for d1yf2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yf2a1