Lineage for d1yema_ (1yem A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through itSuperfamily d.63.1: CYTH-like phosphatases [55154] (3 families) 
Family d.63.1.2: CYTH domain [118007] (5 proteins)
Pfam PF01928
Protein Hypothetical protein PF0863 [118008] (1 species) Species Pyrococcus furiosus [TaxId:2261] [118009] (1 PDB entry)
Uniprot Q8U2H2 2-171
Domain d1yema_: 1yem A: [116646]
Structural genomics target
complexed with pt, unx
Details for d1yema_
PDB Entry: 1yem (more details), 2.3 Å
PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d1yema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
gdfvdievisdspeeakekiwevakmlglkeedveprlyleli
SCOPe Domain Coordinates for d1yema_:
Click to download the PDB-style file with coordinates for d1yema_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yema_:
- d1yema_ first appeared in SCOP 1.71
- d1yema_ appears in SCOPe 2.04
- d1yema_ is called d1yema1 in SCOPe 2.06
- d1yema_ appears in the current release, SCOPe 2.08, called d1yema1
View in 3D
