Lineage for d1ydfa1 (1ydf A:4-256)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.14: NagD-like [102317] (7 proteins)
duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
Protein Putative hydrolase SP1407 [142171] (1 species) Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142172] (1 PDB entry)
Uniprot Q97Q24 3-255
Domain d1ydfa1: 1ydf A:4-256 [122996]
Other proteins in same PDB: d1ydfa2
complexed with mg
Details for d1ydfa1
PDB Entry: 1ydf (more details), 2.6 Å
PDB Description: crystal structure of a had-like phosphatase from streptococcus pneumoniae
PDB Compounds: (A:) Hydrolase, haloacid dehalogenase-like familySCOPe Domain Sequences for d1ydfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydfa1 c.108.1.14 (A:4-256) Putative hydrolase SP1407 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnfni
dtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgldw
qvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyigkp
naiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpiap
thvvsslaewdfd
SCOPe Domain Coordinates for d1ydfa1:
Click to download the PDB-style file with coordinates for d1ydfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ydfa1:
- d1ydfa1 first appeared in SCOP 1.73
- d1ydfa1 appears in SCOPe 2.05
- d1ydfa1 appears in SCOPe 2.07
- d1ydfa1 appears in the current release, SCOPe 2.08
View in 3D
