Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (7 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein Putative hydrolase SP1407 [142171] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142172] (1 PDB entry) Uniprot Q97Q24 3-255 |
Domain d1ydfa1: 1ydf A:4-256 [122996] Other proteins in same PDB: d1ydfa2 complexed with mg |
PDB Entry: 1ydf (more details), 2.6 Å
SCOPe Domain Sequences for d1ydfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ydfa1 c.108.1.14 (A:4-256) Putative hydrolase SP1407 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnfni dtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgldw qvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyigkp naiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpiap thvvsslaewdfd
Timeline for d1ydfa1: