SCOPe 2.03: Domain d1ycfa1: 1ycf A:251-399

Lineage for d1ycfa1 (1ycf A:251-399)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families)
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein Nitric oxide reductase C-terminal domain [142047] (2 species)
Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries)
Uniprot Q9FDN7 251-399
Domain d1ycfa1: 1ycf A:251-399 [122941]
Other proteins in same PDB: d1ycfa2, d1ycfb2, d1ycfc2, d1ycfd2
complexed with feo, fmn, oxy, zn

Details for d1ycfa1

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica

PDB Compounds: (A:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycfa1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

SCOPe Domain Coordinates for d1ycfa1:

Click to download the PDB-style file with coordinates for d1ycfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ycfa1: