| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
| Protein Gelsolin [55759] (2 species) consists of six similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [55761] (32 PDB entries) Uniprot P20065 55-179 |
| Domain d1yagg_: 1yag G: [40846] Other proteins in same PDB: d1yaga1, d1yaga2 domain 1 domain 1 complexed with atp, ca, mg, so4 |
PDB Entry: 1yag (more details), 1.9 Å
SCOPe Domain Sequences for d1yagg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yagg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf
Timeline for d1yagg_: