Lineage for d1yaga2 (1yag A:147-375)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (8 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries) 
Domain d1yaga2: 1yag A:147-375 [33450]
Other proteins in same PDB: d1yagg_
complexed with atp, ca, mg, so4
Details for d1yaga2
PDB Entry: 1yag (more details), 1.9 Å
PDB Description: structure of the yeast actin-human gelsolin segment 1 complex
PDB Compounds: (A:) protein (actin)SCOPe Domain Sequences for d1yaga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaga2 c.55.1.1 (A:147-375) Actin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkcf
SCOPe Domain Coordinates for d1yaga2:
Click to download the PDB-style file with coordinates for d1yaga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yaga2:
- d1yaga2 first appeared (with stable ids) in SCOP 1.55
- d1yaga2 appears in SCOPe 2.05
- d1yaga2 appears in SCOPe 2.07
- d1yaga2 appears in the current release, SCOPe 2.08
View in 3D
