Lineage for d1ya7o1 (1ya7 O:4-231)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726906Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 1726907Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 1726908Protein Proteasome activator protein PA26 [158392] (1 species)
  7. 1726909Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [158393] (1 PDB entry)
    Uniprot Q9U8G2 4-231
  8. 1726910Domain d1ya7o1: 1ya7 O:4-231 [144608]
    Other proteins in same PDB: d1ya7a_, d1ya7b_, d1ya7c_, d1ya7d_, d1ya7e_, d1ya7f_, d1ya7g_, d1ya7h_, d1ya7i_, d1ya7j_, d1ya7k_, d1ya7l_, d1ya7m_, d1ya7n_, d1ya7p_, d1ya7q_, d1ya7r_, d1ya7s_, d1ya7t_, d1ya7u_
    complexed with gol, so4

Details for d1ya7o1

PDB Entry: 1ya7 (more details), 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
PDB Compounds: (O:) proteasome activator protein PA26

SCOPe Domain Sequences for d1ya7o1:

Sequence, based on SEQRES records: (download)

>d1ya7o1 a.24.8.1 (O:4-231) Proteasome activator protein PA26 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1ya7o1 a.24.8.1 (O:4-231) Proteasome activator protein PA26 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOPe Domain Coordinates for d1ya7o1:

Click to download the PDB-style file with coordinates for d1ya7o1.
(The format of our PDB-style files is described here.)

Timeline for d1ya7o1: