Lineage for d1y94a_ (1y94 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) 
Protein Seminal ribonucleasease [54086] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
Uniprot P00669 27-150
Domain d1y94a_: 1y94 A: [116570]
Details for d1y94a_
PDB Entry: 1y94 (more details), 2.2 Å
PDB Description: crystal structure of the g16s/n17t/p19a/s20a/n67d variant of bovine seminal ribonuclease
PDB Compounds: (A:) Seminal ribonucleaseSCOPe Domain Sequences for d1y94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y94a_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv
SCOPe Domain Coordinates for d1y94a_:
Click to download the PDB-style file with coordinates for d1y94a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y94a_:
- d1y94a_ first appeared in SCOP 1.71
- d1y94a_ appears in SCOPe 2.07
View in 3D
