Lineage for d1y8pa1 (1y8p A:12-173)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) 
automatically mapped to Pfam PF10436
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) 
Protein Pyruvate dehydrogenase kinase [69016] (2 species) Species Human (Homo sapiens) [TaxId:9606] [158429] (5 PDB entries)
Uniprot Q15120 13-176
Domain d1y8pa1: 1y8p A:12-173 [144605]
Other proteins in same PDB: d1y8pa3, d1y8pb_
automated match to d2pnrb1
complexed with atp, k, mg, red
Details for d1y8pa1
PDB Entry: 1y8p (more details), 2.63 Å
PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3SCOPe Domain Sequences for d1y8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8pa1 a.29.5.1 (A:12-173) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
vpkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnl
lnrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvi
eykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfg
SCOPe Domain Coordinates for d1y8pa1:
Click to download the PDB-style file with coordinates for d1y8pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y8pa1:
- d1y8pa1 first appeared in SCOP 1.75
- d1y8pa1 appears in SCOPe 2.07
View in 3D
