Lineage for d1y82a1 (1y82 A:2-148)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169006Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2169007Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2169008Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2169040Protein Hypothetical protein PF0355 [142116] (1 species)
    PH0500 ortholog
  7. 2169041Species Pyrococcus furiosus [TaxId:2261] [142117] (1 PDB entry)
    Uniprot Q8U3V0 2-148
  8. 2169042Domain d1y82a1: 1y82 A:2-148 [122732]
    complexed with unx

Details for d1y82a1

PDB Entry: 1y82 (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-367848-001 from pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1y82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y82a1 c.120.1.1 (A:2-148) Hypothetical protein PF0355 {Pyrococcus furiosus [TaxId: 2261]}
plppditfdslalikmhsqsmkkileitlakftvnlsivtvyryltvraylkknieleld
vlkdiynivplneeiaikaaqieadlmrkgmmpdiedvltaataiytksllitddskrye
pmrrfgldtmpldkfvkevelmvekel

SCOPe Domain Coordinates for d1y82a1:

Click to download the PDB-style file with coordinates for d1y82a1.
(The format of our PDB-style files is described here.)

Timeline for d1y82a1: