Lineage for d1y7ya1 (1y7y A:5-73)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913672Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 913717Protein Restriction-modification controller protein C.AhdI [140514] (1 species)
  7. 913718Species Aeromonas hydrophila [TaxId:644] [140515] (1 PDB entry)
    Uniprot Q7X0F0 5-73
  8. 913719Domain d1y7ya1: 1y7y A:5-73 [122729]
    Other proteins in same PDB: d1y7yb_

Details for d1y7ya1

PDB Entry: 1y7y (more details), 1.69 Å

PDB Description: High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila
PDB Compounds: (A:) C.AhdI

SCOPe Domain Sequences for d1y7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]}
hdhyadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklata
ldieprelf

SCOPe Domain Coordinates for d1y7ya1:

Click to download the PDB-style file with coordinates for d1y7ya1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ya1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y7yb_