Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (10 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141998] (1 PDB entry) Uniprot P63788 2-193 |
Domain d1y7oa1: 1y7o A:2-193 [122701] complexed with ca |
PDB Entry: 1y7o (more details), 2.51 Å
SCOPe Domain Sequences for d1y7oa1:
Sequence, based on SEQRES records: (download)
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyly vntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymih qpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqetl eygfideimann
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ipvviesydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvntpggs vsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpmapeh llktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimann
Timeline for d1y7oa1: