Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
Species Haemophilus influenzae [TaxId:727] [142746] (4 PDB entries) Uniprot P45040 2-311 |
Domain d1y7la1: 1y7l A:2-311 [122695] complexed with so4 |
PDB Entry: 1y7l (more details), 1.55 Å
SCOPe Domain Sequences for d1y7la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa serylstalf
Timeline for d1y7la1: