Lineage for d1y7ba2 (1y7b A:4-324)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553770Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1553776Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1553777Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1553791Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 1553800Species Clostridium acetobutylicum [TaxId:1488] [141542] (2 PDB entries)
    Uniprot Q97DM1 2-322
  8. 1553801Domain d1y7ba2: 1y7b A:4-324 [122688]
    Other proteins in same PDB: d1y7ba1, d1y7bb1, d1y7bc1, d1y7bd1
    complexed with ca, epe, gol, pge, so4

Details for d1y7ba2

PDB Entry: 1y7b (more details), 1.6 Å

PDB Description: beta-d-xylosidase, a family 43 glycoside hydrolase
PDB Compounds: (A:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOPe Domain Sequences for d1y7ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ba2 b.67.2.1 (A:4-324) Beta-D-xylosidase N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
iknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtslld
mkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpitln
gsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgtdi
kytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdprns
lqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnwpr
vvggkqgsvnveapkipevkw

SCOPe Domain Coordinates for d1y7ba2:

Click to download the PDB-style file with coordinates for d1y7ba2.
(The format of our PDB-style files is described here.)

Timeline for d1y7ba2: