Lineage for d1y76a1 (1y76 A:4-65)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736302Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2736303Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2736304Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2736305Protein Associated tight junction protein Pals-1 [101290] (2 species)
  7. 2736309Species Norway rat (Rattus norvegicus) [TaxId:10116] [140706] (1 PDB entry)
    Uniprot Q63ZW7 4-65
    identical sequence to mouse domain
  8. 2736310Domain d1y76a1: 1y76 A:4-65 [122683]
    Other proteins in same PDB: d1y76b1, d1y76d_

Details for d1y76a1

PDB Entry: 1y76 (more details)

PDB Description: solution structure of patj/pals1 l27 domain complex
PDB Compounds: (A:) protein associated to tight junctions

SCOPe Domain Sequences for d1y76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y76a1 a.194.1.1 (A:4-65) Associated tight junction protein Pals-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
npaaekmqvlqvldrlrgklqekgdttqneklsafyetlksplfnqiltlqqsikqlkgq
ls

SCOPe Domain Coordinates for d1y76a1:

Click to download the PDB-style file with coordinates for d1y76a1.
(The format of our PDB-style files is described here.)

Timeline for d1y76a1: