Lineage for d1y6ha_ (1y6h A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. Protein Peptide deformylase [56422] (11 species)
  7. Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries)
    Uniprot Q72S74
  8. Domain d1y6ha_: 1y6h A: [116505]
    complexed with fmt, gly, zn

Details for d1y6ha_

PDB Entry: 1y6h (more details), 2.2 Å

PDB Description: Crystal structure of LIPDF
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1y6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld

SCOPe Domain Coordinates for d1y6ha_ are not available.

Timeline for d1y6ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y6hb_