Lineage for d1y67a1 (1y67 A:2-89)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904342Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 904343Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 904469Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 904480Species Deinococcus radiodurans [TaxId:1299] [116763] (2 PDB entries)
    Uniprot Q9RUV2
  8. 904481Domain d1y67a1: 1y67 A:2-89 [116496]
    Other proteins in same PDB: d1y67a2, d1y67b2, d1y67c2, d1y67d2
    complexed with fe

Details for d1y67a1

PDB Entry: 1y67 (more details), 1.85 Å

PDB Description: crystal structure of manganese superoxide dismutase from deinococcus radiodurans
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1y67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y67a1 a.2.11.1 (A:2-89) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]}
aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
rvpadkkgalrnnagghanhsmfwqimg

SCOPe Domain Coordinates for d1y67a1:

Click to download the PDB-style file with coordinates for d1y67a1.
(The format of our PDB-style files is described here.)

Timeline for d1y67a1: